pLVX-DsRed-Monomer-N1 Search name
pLVX-DsRed-Monomer-N1,Plasmid pLVX-DsRed-Monomer-N1,pLVX-DsRed-Monomer-N1 vector
pLVX-DsRed-Monomer-N1 Information
Promoter: PGK, CMV
Replicon: pUC ori
Terminator: SV40 poly (A) signal
Plasmid classification: virus series, lentivirus cloning vector
Plasmid size: 8751bp
Prokaryotic resistance: Amp
Screening markers: Puro
Cloned strain: Stbl3
Culture conditions: 37 centigrade, aerobic LB
Expression host: mammalian cells
Induction mode: no induction, instantaneous expression
5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG
3'sequencing primers: primers designed according to sequence
Use:Lentiviral
pLVX-DsRed-Monomer-N1 Description
Plvx-dsred-monomer-n1 is a HIV-1, a lentivirus expression vector that allows you to express your interest in gene fusion, DsRed Monomer, a single mutant red fluorescent protein Discosoma sp.. The gene was cloned to the polyclonal site (MCS), which was located upstream of the gene coding sequence of the monomer and expressed as N's monomer protein fusion protein. The expression of fusion protein is composed of constitutive activated human cytomegalovirus immediate early promoter (CMV), which is located in the upstream MCS only. Lentivirus particles come from vectors that allow the expression of red fluorescent protein monomer fusion protein in almost any type of cells, including primary cells. The DsRed Monomer indicates that the unmodified vector can be used to produce labeled viruses and optimize the infection protocol.
Plvx-dsred-monomer-n1 contains all the necessary virus processing units to reproduce incompetent virus production, as well as elements to improve virus titer, transgene expression and overall carrier function. The post transcriptional regulatory element (WPRE) of the groundhog hepatitis virus (HBV) promotes RNA treatment events to increase the nuclear exportation of the virus and transgenic RNA, causing the virus titer to increase the packaging cells and enhance the expression of your genes in the target cells. In addition, the vector includes Rev response element (RRE), which further increases the titer of virus and enhances the transport of spliced virus RNA into the nucleus. Finally, pLVX DsRed - monomer-n1 also contains a central polypurine channel (CPPT) element that increases the input of the virus genome in the process of target cell infection, leading to improved carrier integration and more effective transduction.
pLVX-DsRed-Monomer-N1 Sequence
LOCUS Exported 8751 bp ds-DNA circular SYN 07-SEP-2016
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS Untitled 3
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8751)
AUTHORS .
TITLE Direct Submission
JOURNAL Exported Wednesday, September 7, 2016 from SnapGene Viewer 3.1.4
FEATURES Location/Qualifiers
source 1..8751
/organism="synthetic DNA construct"
/mol_type="other DNA"
LTR 1..634
/note="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 681..806
/note="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 1303..1536
/note="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
misc_feature 2028..2143
/note="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1 (lacking the first T)"
enhancer 2201..2504
/note="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 2505..2708
/note="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
misc_feature 2793..2873
/note="MCS"
/note="multiple cloning site"
CDS 2881..3558
/codon_start=1
/product="monomeric derivative of DsRed fluorescent protein
(Strongin et al., 2007)"
/note="DsRed-Monomer"
/note="mammalian codon-optimized"
/translation="MDNTEDVIKEFMQFKVRMEGSVNGHYFEIEGEGEGKPYEGTQTAK
LQVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYMKLSFPEGFTWERSMNFEDGGV
VEVQQDSSLQDGTFIYKVKFKGVNFPADGPVMQKKTAGWEPSTEKLYPQDGVLKGEISH
ALKLKDGGHYTCDFKTVYKAKKPVQLPGNHYVDSKLDITNHNEDYTVVEQYEHAEARHS
GSQ"
promoter 3587..4086
/note="PGK promoter"
/note="mouse phosphoglycerate kinase 1 promoter"
CDS 4107..4706
/codon_start=1
/gene="pac from Streptomyces alboniger"
/product="puromycin N-acetyltransferase"
/note="PuroR"
/note="confers resistance to puromycin"
/translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
misc_feature 4720..5308
/note="WPRE"
/note="woodchuck hepatitis virus posttranscriptional
regulatory element"
CDS complement(5191..5202)
/codon_start=1
/product="Factor Xa recognition and cleavage site"
/note="Factor Xa site"
/translation="IEGR"
LTR 5515..6148
/note="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
primer_bind complement(6276..6292)
/note="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 6300..6316
/bound_moiety="lac repressor encoded by lacI"
/note="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(6324..6354)
/note="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 6369..6390
/bound_moiety="E. coli catabolite activator protein"
/note="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(6678..7266)
温馨提示：不可用于临床ZL。
