pIRES2-EGFP Search name
pIRES2-EGFP,Plasmid pIRES2-EGFP,pIRES2-EGFP vector
pIRES2-EGFP Informaiton
Promoter: CMV
Replicon: pUC ori, F1 ori
Terminator: SV40 poly (A) signal
Plasmid classification: mammalian cells, fluorescent protein reporter vectors
Plasmid size: 5308bp
Prokaryotic resistance: Kan
Selection marker: Neo
Clonal strain: DH5 alpha
Culture conditions: 37 C, aerobic LB
Expression host: lactation cells
Induction mode: no need to induce, transient expression.
5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG
3'sequencing primers: pEGFP-N-3:CGTCGCCGTCCAGCTCGACCAG
pIRES2-EGFP Sequence
pIRES2-EGFP contains the internal ribosome entry site (IRES; 1, 2) of the encephalomyocarditis virus (ECMV) between the MCS and the enhanced green fluorescent protein (EGFP) coding region.This permits both the gene of interest (cloned into the MCS) and the EGFP gene to be translated from a single bicistronic mRNA. pIRES2-EGFP is designed for the efficient selection (by flow cytometry or other methods) of transiently transfected mammalian cells expressing EGFP and the protein of interest. This vector can also be used to express EGFP alone or to obtain stably transfected cell lines without time-consuming drug and clonal selection.
pIRES2-EGFP Multiple cloning site
pIRES2-EGFP Sequence
LOCUS Exported 5308 bp ds-DNA circular SYN 31-AUG-2016
DEFINITION synthetic circular DNA
ACCESSION .
VERSION .
KEYWORDS pIRES2-EGFP
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5308)
AUTHORS admin
TITLE Direct Submission
JOURNAL Exported 2015-10-22 from
REFERENCE 2 (bases 1 to 5308)
AUTHORS .
TITLE Direct Submission
JOURNAL Exported Thursday, September 1, 2016 from SnapGene Viewer 3.1.4
http://www.miaolingbio.com
FEATURES Location/Qualifiers
source 1..5308
/organism="synthetic DNA construct"
/mol_type="other DNA"
enhancer 61..364
/note="CMV enhancer"
/note="CMV enhancer;human cytomegalovirus immediate early
enhancer"
promoter 365..568
/note="CMV promoter"
/note="CMV promoter;human cytomegalovirus (CMV) immediate
early promoter"
misc_feature 609..665
/note="MCS"
/note="MCS;multiple cloning site"
misc_feature 667..1253
/note="IRES2"
/note="IRES2;internal ribosome entry site (IRES) of the
encephalomyocarditis virus (EMCV)"
CDS 1254..1973
/codon_start=1
/product="enhanced GFP"
/note="enhanced GFP"
/note="EGFP;mammalian codon-optimized"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
EFVTAAGITLGMDELYK"
polyA_signal 2096..2217
/note="SV40 poly(A) signal"
/note="SV40 poly(A) signal;SV40 polyadenylation signal"
rep_origin complement(2224..2679)
/direction=LEFT
/note="f1 ori"
/note="f1 ori;f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2706..2810
/gene="bla"
/note="bla AmpR promoter"
/note="AmpR promoter"
promoter 2812..3169
/note="SV40 promoter"
/note="SV40 promoter;SV40 enhancer and early promoter"
rep_origin 3020..3155
/note="SV40 ori"
/note="SV40 ori;SV40 origin of replication"
CDS 3204..3998
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/note="aph(3')-II (or nptII)"
/note="NeoR/KanR;confers resistance to neomycin, kanamycin,
and G418 (Geneticin(R))"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 4230..4277
/note="HSV TK poly(A) signal"
/note="HSV TK poly(A) signal;herpesvirus thymidine kinase
polyadenylation signal"
rep_origin 4606..5194
/direction=RIGHT
/note="ori"
/note="ori;high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
ORIGIN
1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg
61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt
121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca
181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc
241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta
301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac
361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg
421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg
481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt
541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta
601 ccggactcag atctcgagct caagcttcga attctgcagt cgacggtacc gcgggcccgg
661 gatccgcccc tctccctccc ccccccctaa cgttactggc cgaagccgct tggaataagg
721 ccggtgtgcg tttgtctata tgttattttc caccatattg ccgtcttttg gcaatgtgag
781 ggcccggaaa cctggccctg tcttcttgac gagcattcct aggggtcttt cccctctcgc
841 caaaggaatg caaggtctgt tgaatgtcgt gaaggaagca gttcctctgg aagcttcttg
901 aagacaaaca acgtctgtag cgaccctttg caggcagcgg aaccccccac ctggcgacag
961 gtgcctctgc ggccaaaagc cacgtgtata agatacacct gcaaaggcgg cacaacccca
1021 gtgccacgtt gtgagttgga tagttgtgga aagagtcaaa tggctctcct caagcgtatt
温馨提示：不可用于临床ZL。
