This mouse monoclonal antibody was generated against the ED3 domain of the Zika virus E protein, and recognizes ZIKV E protein, ED3 domain .
Highlights:
Zika virus (ZIKV) is a member of the virus family Flaviviridae and the genus Flavivirus, transmitted by daytime-active Aedes mosquitoes. Zika is related to other mosquito transmitted viruses such as dengue, yellow fever, Japanese encephalitis and West Nile. Similar to other flaviviruses, ZIKV is enveloped and icosahedral and has a nonsegmented, single-stranded, positive-sense RNA genome. Common symptoms of infection with the virus include mild headaches, maculopapular rash, fever, malaise, conjunctivitis, and joint pains.
SPECIFICATIONS
| Product Type: | Antibody |
| Accession ID: | A0A1C8L488 |
| Organism: | mouse |
| Antigen: | Zika virus ED3 |
| Molecular Weight: | 12.1 kDa |
| Isotype: | IgG2b,k |
| Clonality: | Monoclonal |
| Clone Name: | 3E10D1 |
| Reactivity: | Zika virus |
| Immunogen: | Bacterial expressed ED3 (dklrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti) |
| Epitope: | Zika ED3 |
| Purification Method: | Protein G |
| Tested Applications: | IF (1: 2000); showed suitability for WB and IFA (1µg/ml for WB and 0.1-10µg/mL for IFA) |
| Storage: | -20C |
| Shipped: | Cold packs |
![Anti-Zika Virus <em>Envelope</em> (E) <em>Protein</em>, ED3 Domain [3E10D1] <em>Antibody</em>, 100ug](https://item.yiqi.com/pic/CovPic/4/A1353483476.jpg)
