Recombinant Human Tissue Factor Pathway Inhibitor 2Synonyms TFPI-2, REF1,Placental protein 52.
Introduction TFPI2 takes part in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 doesn’t have any influence on thrombin.
Recombinant Human Tissue Factor Pathway Inhibitor 2Description TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Source Nicotiana benthamiana
Physical Appearence Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.
Solubility It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.
Stability Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFPI2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Recombinant Human Tissue Factor Pathway Inhibitor 2Purity Greater than 97.0% as determined by SDS-PAGE.
Amino Acid Sequence HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
Biological Activity The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein.
Recombinant Human Tissue Factor Pathway Inhibitor 2Usage CHIs products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
