pmCherry-C1 PVT1233 2ug
Search name
pmCherry-C1,Plasmid pmCherry-C1,pmCherry-C1 vector
pmCherry-C1 Information
Promoter: CMV
Replicon: pUC ori, F1 ori
Terminator: SV40 poly (A) signal
Plasmid Classification: Mammalian Cells, Fluorescent Protein Reporting Vectors
Plasmid size: 4722 BP
Prokaryotic resistance: Kan
Screening Marker: Neo
Cloning strain: DH5alpha
Culture conditions: 37 C, aerobic LB
Expression host: mammalian cells
Induction mode: no induction, transient expression
5'Sequencing Primer: mCherry-F: AACGAGCTACACCATCGT
3'Sequencing primers: Sv40-polyA-R: GAAATTTGATGCTATTGC
pmCherry-C1 Description
pmCherry-C1 is a mammalian expression vector designed to express a protein of interest fused to the C-terminus of mCherry, a mutant fuorescent protein derived from the tetrameric Discosoma sp. red fuorescent protein, DsRed (1). The excitation and emission maxima of the native mCherry protein are 587 nm and 610 nm, respectively. Expression of fusion proteins that retain the fuorescent properties of the unmodifed mCherry protein can be monitored by fow cytometry and their localization in vivo can be determined by fuorescence microscopy.
pmCherry-C1 Sites
pmCherry-C1 Sequence
LOCUS Exported 4722 bp ds-DNA circular SYN 22-10-2015
DEFINITION .
ACCESSION .
VERSION .
KEYWORDS Untitled 5
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4722)
AUTHORS admin
TITLE Direct Submission
JOURNAL Exported 2015-10-22
FEATURES Location/Qualifiers
source 1..4722
/organism="synthetic DNA construct"
/mol_type="other DNA"
enhancer 61..364
/note="CMV enhancer"
/note="human cytomegalovirus immediate early enhancer"
promoter 365..568
/note="CMV promoter"
/note="human cytomegalovirus (CMV) immediate early
promoter"
CDS 613..1320
/codon_start=1
/product="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
/note="mCherry"
/note="mammalian codon-optimized"
/translation="MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEG
TQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNF
EDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALK
GEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERA
EGRHSTGGMDELYK"
misc_feature 1321..1386
/note="MCS"
/note="multiple cloning site"
polyA_signal 1510..1631
/note="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
rep_origin complement(1638..2093)
/direction=LEFT
/note="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2120..2224
/gene="bla"
/note="AmpR promoter"
promoter 2226..2583
/note="SV40 promoter"
/note="SV40 enhancer and early promoter"
rep_origin 2434..2569
/note="SV40 ori"
/note="SV40 origin of replication"
CDS 2618..3412
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/note="NeoR/KanR"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin(R))"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 3644..3691
/note="HSV TK poly(A) signal"
/note="herpesvirus thymidine kinase polyadenylation signal"
rep_origin 4020..4608
/direction=RIGHT
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
ORIGIN
1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg
61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt
121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca
181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc
241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta
301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac
361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg
421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg
481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt
541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta
601 ccggtcgcca ccatggtgag caagggcgag gaggataaca tggccatcat caaggagttc
661 atgcgcttca aggtgcacat ggagggctcc gtgaacggcc acgagttcga gatcgagggc
721 gagggcgagg gccgccccta cgagggcacc cagaccgcca agctgaaggt gaccaagggt
781 ggccccctgc ccttcgcctg ggacatcctg tcccctcagt tcatgtacgg ctccaaggcc
841 tacgtgaagc accccgccga catccccgac tacttgaagc tgtccttccc cgagggcttc
901 aagtgggagc gcgtgatgaa cttcgaggac ggcggcgtgg tgaccgtgac ccaggactcc
961 tccctgcagg acggcgagtt catctacaag gtgaagctgc gcggcaccaa cttcccctcc
1021 gacggccccg taatgcagaa gaagaccatg ggctgggagg cctcctccga gcggatgtac
1081 cccgaggacg gcgccctgaa gggcgagatc aagcagaggc tgaagctgaa ggacggcggc
1141 cactacgacg ctgaggtcaa gaccacctac aaggccaaga agcccgtgca gctgcccggc
1201 gcctacaacg tcaacatcaa gttggacatc acctcccaca acgaggacta caccatcgtg
1261 gaacagtacg aacgcgccga gggccgccac tccaccggcg gcatggacga gctgtacaag
1321 tccggactca gatctcgagc tcaagcttcg aattctgcag tcgacggtac cgcgggcccg
1381 ggatccaccg gatctagata actgatcata atcagccata ccacatttgt agaggtttta
1441 cttgctttaa aaaacctccc acacctcccc ctgaacctga aacataaaat gaatgcaatt
1501 gttgttgtta acttgtttat tgcagcttat aatggttaca aataaagcaa tagcatcaca
1561 aatttcacaa ataaagcatt tttttcactg cattctagtt gtggtttgtc caaactcatc
1621 aatgtatctt aacgcgtaaa ttgtaagcgt taatattttg ttaaaattcg cgttaaattt
1681 ttgttaaatc agctcatttt ttaaccaata ggccgaaatc ggcaaaatcc cttataaatc
1741 aaaagaatag accgagatag ggttgagtgt <
温馨提示：不可用于临床ZL。
